Anti-IDH1

Artikelnummer: ATA-AMAB90578
Artikelname: Anti-IDH1
Artikelnummer: ATA-AMAB90578
Hersteller Artikelnummer: AMAb90578
Alternativnummer: ATA-AMAB90578-100,ATA-AMAB90578-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
isocitrate dehydrogenase 1 (NADP+), soluble
Anti-IDH1
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL0219]
Isotyp: IgG2a
NCBI: 3417
UniProt: O75874
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IDH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunofluorescence staining of A-431 cells using the anti-IDH1 monoclonal antibody, showing specific staining in the cytosol and nuclear bodies in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemical staining of human kidney shows strong positivity in a subset of renal tubules.
Immunohistochemical staining of human testis shows strong immunoreactivity in seminiferous tubules.
Immunohistochemical staining of human prostate shows strong positivity in glandular epithelium.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90578-100ul
AMAb90578-100ul
AMAb90578-100ul