Anti-ATRX Antibody , IgG1, Clone: [CL0537], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90784
Artikelname: Anti-ATRX Antibody , IgG1, Clone: [CL0537], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90784
Hersteller Artikelnummer: AMAb90784
Alternativnummer: ATA-AMAB90784-100,ATA-AMAB90784-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JMS, RAD54, XH2, XNP
alpha thalassemia/mental retardation syndrome X-linked
Anti-ATRX
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0537]
Isotyp: IgG1
NCBI: 546
UniProt: P46100
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ATRX
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunofluorescence staining in HeLa cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in A431 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in MCF7 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in U251 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunohistochemical staining of human glioma shows strong nuclear positivity in tumor cells.
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.
Staining of human liver shows no positivity in hepatocytes as expected.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line A-549.
AMAb90784
AMAb90784
AMAb90784