BCL2A1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0134
Artikelname: BCL2A1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0134
Hersteller Artikelnummer: A0134
Alternativnummer: ABB-A0134-20UL,ABB-A0134-100UL,ABB-A0134-1000UL,ABB-A0134-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GRS, ACC1, ACC2, BFL1, ACC-1, ACC-2, HBPA1, BCL2L5, BCL2A1
This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 597
UniProt: Q16548
Reinheit: Affinity purification
Sequenz: LFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
Target-Kategorie: BCL2A1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,B Cell Receptor Signaling Pathway.
Immunofluorescence anal