PI3 Kinase p85 alpha Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PI3 Kinase p85 alpha Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0054
• Hersteller Artikelnummer: A0054
• Alternativnummer: ABB-A0054-100UL,ABB-A0054-200UL,ABB-A0054-20UL,ABB-A0054-1000UL,ABB-A0054-50UL,ABB-A0054-500UL,ABB-A0054-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 125-320 of human PI3 Kinase p85 alpha (NP_852664.1).
• Konjugation: Unconjugated
• Alternative Synonym: p85, AGM7, GRB1, IMD36, p85alpha, p85-ALPHA, PI3 Kinase p85 alpha

Produktbeschreibung

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory su

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 84kDa
• NCBI: 5295
• UniProt: P27986
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: PDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANN
• Target-Kategorie: PIK3R1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Rat, Research area: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,Kinase,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,ErbB-HER Signaling