PPP2CA Peptide - N-terminal region

Catalog Number: BYT-ORB2004256
Article Name: PPP2CA Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004256
Supplier Catalog Number: orb2004256
Alternative Catalog Number: BYT-ORB2004256-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
PPP2CA Peptide - N-terminal region
UniProt: P67775
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PPP2CA Rabbit Polyclonal Antibody (orb583049). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings