Filteroptionen
Kategorien
Antibody Type
Spezies-Reaktivität
- a. thaliana (99)
- aids (hiv) (2)
- algae (166)
- all (351)
- arachnid (82)
- aspergillus (399)
- aves (105)
- b. pertussis (410)
- bacillus (28)
- bacteria (249751)
- bat (1)
- bear (29)
- bee (50)
- bovine (6772)
- c. elegans (8)
- camelus (15)
- canine (2048)
- chemical (1)
- chimeric (6)
- chinese hamster (133)
- chlamydomonas reinhardtii (chlamydomonas smithii) (2)
- cho (3e7 cell line) (1)
- cho (s cell line) (1)
- cho (s-cell line) (1)
- clostridium (3625)
- crustacean (32)
- cynomolgus mky (23)
- donkey (14)
- drosophila (2889)
- duck (2)
- e. coli (20440)
- ebv (40)
- equine (451)
- feline (201)
- ferret (6)
- fipvn (1)
- firefly (3)
- fish (1882)
- frog (2779)
- fungi (326)
- gallus (2336)
- goat (243)
- golden hamster (176)
- guinea pig (333)
- h. pylori (887)
- hamster (48)
- hbv (17)
- hcmv (43)
- hcv (25)
- hhv-8 (1)
- hpv (11)
- hpv 16 (9)
- hrp2 (1)
- hsv (6)
- hsv-1 (7)
- htlv-1 (2)
- hu (393)
- humam (1)
- human (154692)
- hvc (2)
- insect (659)
- invertebrate (55)
- jellyfish (15)
- lcmv (12)
- m. tuberculosis (2)
- mammal (27)
- marmoset (8)
- mcmv (5)
- mink (2)
- mollusc (1)
- monkey (5467)
- mouse (37252)
- mouse/human chimeric (2)
- ms (153)
- murine (3)
- other (12421)
- p27 (1)
- parasite (498)
- peptostreptococcus magnus (1)
- plant (12590)
- plasmodium (27)
- porcine (3463)
- primate (548)
- protozoa (2179)
- pseudomonas sp (4)
- rabbit (1535)
- rabies virus (34)
- radish (1)
- rat (18356)
- rat and mouse (2)
- reptile (161)
- rhesus mky (7)
- rodent (16)
- s. japonicum (2)
- saccharomyces (4)
- sars (3)
- sars-cov-2 (5)
- scophthalmus maximus (turbot) (psetta maxima) (2)
- scorpion (160)
- sheep (818)
- snail (2)
- snake (263)
- staphylococcus aureus (2)
- streptococcus sp (1)
- vacv (3)
- virus (8267)
- vzv (1)
- worm (143)
- xenopus (14)
- yeast (266)
- zebrafish (489)
Wirt
- a. thaliana (20)
- a/new caledonia/20/99 (h1n1) (1)
- aves (1)
- bacillus (2)
- bacteria (829)
- bee (1)
- bhk-21 cells/strain no. 15 (1)
- bl21 de3 strainbacteria (26)
- bl21de3 plys s (1)
- bovine (267)
- c. elegans (3)
- camelid / alpaka (1)
- camelid/alpaka (4)
- camelus (10)
- campylobacter culture (1)
- canine (54)
- chinese hamster (514)
- cho cells (1)
- clostridium (4)
- cmv strain ad169 (1)
- corynebacterium diphtheria culture (1)
- crfk cells/strain cornell (2)
- crfk cells/strain petaluma (1)
- crfk cells/strain wsu 79-1146 (1)
- crustacean (4)
- donkey (2)
- drosophila (31)
- duck (1)
- e. coli (159607)
- e6 cells/lederle (1)
- e6 cells/strain b956 (uganda) (1)
- e6 cells/strain edmonston (1)
- e6 cells/strain h241 (1)
- e6 cells/strain jeryl lynn (1)
- e6 cells/strain mr 766 (1)
- e6 cells/strain th-sman (1)
- equine (13)
- fc 3tg cells (1)
- feline (8)
- fish (4)
- frog (1)
- fungi (277)
- gallus (85)
- gastric biopsy (1)
- goat (103)
- guinea pig (6)
- h. pylori (7)
- hamster (15)
- hep-2 cells (1)
- hep-2 cells/strain long (1)
- hsv-1 macintyre strain (4)
- hsv-1 strain macintyre (1)
- human (69361)
- infected cell lystate (1)
- insect (3381)
- invertebrate (1)
- jellyfish (2)
- l. pneumophila culture (1)
- liver carcinoma (2)
- llc cells/strain abney (1)
- llc-mk2 cells/strain sa-11 (1)
- mammal (5042)
- mammalian cell expression (hek293) (1)
- mccoy/strain lgvii/434 (2)
- monkey (114)
- mouse (819)
- mrc-5 cells (1)
- mrc-5 cells/strain ad169 (2)
- mrc-5 cells/strain adenoid 6 (1)
- mrc-5 cells/strain ellen (1)
- nhdf cells/strain ad169 (3)
- nhdf cells/strain ellen (2)
- other (63)
- parasite (11)
- plant (261)
- porcine (92)
- primate (36)
- rabbit (182)
- rabies virus (6)
- rat (209)
- recombinant hcg beta (1)
- reptile (7)
- rh strain in glycine buffer (1)
- rh strain in pbs (1)
- rodent (2)
- s. enteritidis culture (1)
- s. paratyphi a culture (1)
- s. typhi culture (1)
- s. typhimurium culture (1)
- sheep (33)
- strain 385-99 (new york) (1)
- strain atcc 33153 (1)
- strain cocktail blend (1)
- strain fh (2)
- strain g (5)
- strain lgvii (1)
- strain lv8 (1)
- synthesized (1)
- synthetic (4)
- vero cells/strain 16681 (1)
- vero cells/strain edmonston (1)
- vero cells/strain hpv77 (1)
- vero cells/strain long (1)
- virus (5636)
- whole tachyzoites (1)
- xenopus (3)
- yeast (1757)
- zebrafish (6)
Markierung
- 10xHis at the C-terminus (36)
- 10xHis at the N-terminus (9)
- 5-FAM (3)
- 6xHis at the C-terminus (3)
- 8xHis at the C-terminus (4)
- AF488 (58)
- AF555 (16)
- AF594 (1)
- AF647 (44)
- AFRed 780 (1)
- AFViolet 450 (1)
- ALP (3)
- ANC (2)
- AP (22)
- APC (519)
- APC/Cy7 (3)
- Agarose (34)
- Azide (2)
- Azide 647/RECOM (3)
- BGAL (1)
- BSA (393)
- BgG (1)
- Biotin (5539)
- Brilliant Violet 421 (4)
- CV/GMP/RECOM (80)
- Chromeo™ 488 (2)
- Chromeo™ 546 (2)
- Chromeo™ 642 (2)
- Cy3 (7)
- Cy5 (10)
- Cyanine 2 (1)
- Cyanine 3.5 (1)
- Cyanine 5.5, R-PE (2)
- DL405 (1)
- Dyomics 647 (1)
- FITC (322)
- GFP (33)
- Gold (1)
- HRP (223)
- HSA (5)
- KLH (91)
- N/A (225)
- OVA (871)
- PE (268)
- PE/Cy5 (2)
- PE/Cy7 (7)
- Peptide (3)
- PerCP (1)
- PerCP/Cy5.5 (4)
- PerCP/SureLight (2)
- RFP (2)
- RPE (12)
- Rhodamine (7)
- SA (2)
- Sepharose (16)
- Sulfo-Cy7.5 (3)
- TRITC (63)
- Texas Red (40)
- Unconjugated (96334)
Hersteller
- 3Helix (12)
- ABP Biosciences (12)
- ABclonal (2121)
- ADS Biotec Ltd (1)
- ALPCO (35)
- ARP American Research Products (1)
- Abbexa (26399)
- Abbkine Scientific (232)
- Abcepta (24360)
- Abeomics (14461)
- Abiel (6)
- Abnova (18360)
- AcroBiosystems (9488)
- Active Motif (1414)
- Affinity Biosciences (15650)
- Agdia EMEA (20)
- Agrisera (21)
- Alpha Diagnostic (4661)
- Ampersand Biosciences (58)
- Anatrace (42)
- Anogen-Yes Biotech Laboratories (169)
- Antibodies Incorporated (3)
- Antibodies.com (32585)
- ApexBio (871)
- Aptum Biologics (15)
- Arbor Assays (6)
- Arlington Scientific (4)
- Atlas Antibodies (34)
- Aves Labs (1)
- Aviva (382103)
- BBI Solutions (87)
- BIO SB (19)
- BIOMAT (3)
- BIOZOL (1)
- BT Lab (1)
- Bachem (5)
- BellBrook Labs (53)
- Bio X Cell (12)
- BioAssay Works (28)
- BioChain Institute (455)
- BioChem Fluidics (3)
- BioPorto Diagnostics (6)
- BioServUK (97)
- BioTeZ (1)
- BioVendor (454)
- Biogenex (1)
- Biolegend (2277)
- Biomatik Corporation (22385)
- Biorbyt (273254)
- Bioss (9996)
- Biosynth (14926)
- Biotium (43)
- Bioworld Technology (512)
- BlueGene (882)
- Boster Bio (2636)
- BrainXell (4)
- Calibre Scientific (2)
- Cape Biologix Technologies (4)
- Cedarlane (17329)
- Cell Biolabs (32)
- Chondrex (10)
- Clonit (1)
- Cloud-Clone (14873)
- Columbia Biosciences (13)
- Covalab (91)
- Creative BioMart (49605)
- Creative Biolabs (16589)
- Cusabio (483416)
- Cygnus Technologies (79)
- Cytoskeleton (129)
- DIAsource ImmunoAssays (1)
- Daresbury Proteins (55)
- ELK Biotechnology (307)
- EXBIO (11)
- EastCoast Bio (584)
- Elabscience (8923)
- EnkiLife (2526)
- Enzo Life Sciences (789)
- EuroClone (11)
- Everest (1)
- FabGennix (2)
- Focus Biomolecules (3)
- Fujifilm Irvine Scientific (545)
- Fuller (2)
- Future Fields (6)
- GeneDireX (21)
- GeneTex (7094)
- Genesee Scientific (41)
- GenomeMe (1)
- Genscript (2618)
- HUMAN (3)
- HansaBioMed (2)
- HelloBio (70)
- Hycult (25)
- IBA (4)
- IBI Scientific (384)
- ICL (85)
- IPHASE Biosciences (23)
- ImmuQuest (1)
- ImmunoChemistry Technologies (53)
- ImmunoReagents (2)
- Immunostep (1)
- Invent BioTechnologies (3)
- Jackson ImmunoResearch (15)
- Kamiya Biomedical Company (10)
- Kerafast (171)
- Krishgen Biosystems (22)
- Lab-Club (7)
- Lampire Biological Labs (2)
- Leadgene Biomedical (1244)
- LifeSpan Biosciences (234572)
- LifeTein (18)
- Linaris (206)
- List Biological Labs (31)
- MABTECH (3)
- MBL (1744)
- MERCK Millipore (1)
- MP Biomedicals Germany (153)
- MedchemExpress (21830)
- Medix Biochemica (23)
- MoBiTec (17)
- Molecular Dimension (24)
- Monosan (1)
- MyBiosource (310374)
- NABAS (1)
- NZYtech (28)
- NanoHelix (3)
- NanoTag Biotechnologies (8)
- Nanoprobes (1)
- NeXtal (1)
- Neuromics (779)
- Nordic BioSite (57396)
- NordicMubio (120)
- OZ Biosciences (9)
- Oasis Diagnostics (1)
- Oxford Biomedical Research (82)
- PBL Assay Science (59)
- ProSci (9264)
- ProSpec-Tany Technogene (6051)
- ProteinArk (85)
- ProteoGenix (10195)
- Qkine (484)
- RayBiotech (34438)
- Reprocell (9)
- Roboscreen (16)
- Rockland Immunochemicals (953)
- Sceti (1038)
- ScyTek Laboratories (20)
- SeLENOZYME (54)
- SignalChem (2098)
- SignalChem Diagnostics (168)
- Sino Biological (8232)
- SouthernBiotech (40)
- Spherotech (1)
- Synabs (42)
- TdB Labs (121)
- The Native Antigen Company (927)
- Toronto Bioscience (35)
- Trevigen (3)
- U-CyTech biosciences (1)
- UBPBio, LLC (31)
- US Biological (9)
- Vazyme Biotech (18)
- Vector Laboratories (26)
- VectorBuilder (6)
- ViroStat (65)
- Virusys (13)
- Yashraj Biotechnology (55)
- ZellBio (32)
- Zymo Research Europe (9)
- Zytomed Systems (31)
- magtivio (12)
- nanoComposix (4)
- peptides and elephants (1871)
- reddot Biotech (5)
- trenzyme (1)
Isotyp
- a24kb (chimera) (5)
- a2kb (chimera) (1)
- dpb1*04:01 (5)
- drb1*01:01 (10)
- drb1*03:01 (6)
- drb1*04:01 (10)
- drb1*04:05 (1)
- drb1*07:01 (1)
- drb1*08:03 (1)
- drb1*09:01 (1)
- drb1*15:01 (9)
- drb1*15:02 (1)
- drb4*01:01 (1)
- h-2db (49)
- h-2dd (8)
- h-2dk (7)
- h-2kb (44)
- h-2kd (30)
- h-2kk (1)
- h-2ld (12)
- hla-a*01:01 (13)
- hla-a*02:01 (157)
- hla-a*02:02 (1)
- hla-a*02:06 (1)
- hla-a*02:07 (1)
- hla-a*03:01 (24)
- hla-a*03:02 (1)
- hla-a*11:01 (7)
- hla-a*23:01 (5)
- hla-a*24:02 (30)
- hla-a*26:01 (5)
- hla-a*29:02 (5)
- hla-a*31:01 (1)
- hla-a24:02 (1)
- hla-b*07:02 (12)
- hla-b*08:01 (8)
- hla-b*15:01 (7)
- hla-b*27:05 (12)
- hla-b*35:01 (15)
- hla-b*40:01 (5)
- hla-b*40:02 (1)
- hla-b*40:06 (5)
- hla-b*52:01 (1)
- hla-b*54:01 (1)
- hla-b*57:01 (8)
- hla-c*01:02 (1)
- hla-c*03:03 (1)
- hla-c*03:04 (1)
- hla-c*04:01 (1)
- hla-c*06:02 (4)
- hla-c*08:01 (5)
- hla-c*12:02 (3)
- hla-c*15:02 (1)
- hla-drb1*01:01 (2)
- hla-drb1*04:01 (2)
- hla-drb1*15:01 (2)
- hla-e*01:01 (5)
- hla-e*01:03 (5)
- i-ab (2)
- i-ak (1)
- iga (7)
- iga kappa (4)
- ige (3)
- ige kappa (4)
- igg (11)
- igg1 (33)
- igg1 kappa (8)
- igg1 lambda (2)
- igg2 (1)
- igg2a (29)
- igg2a kappa (8)
- igg2b (13)
- igg2b kappa (4)
- igg2c (1)
- igg2c kappa (4)
- igg3 (13)
- igg3 kappa (2)
- igm (49)
- igm kappa (4)
- igy (1)
- k (13)
- mafa-a1*063 (13)
- mafa-b*104:01 (10)
- mamu-a*01 (7)
- mamu-b*08 (4)
- multi allele (1)
- qa-1b (7)
Klon-Bezeichnung
- 15 (1)
- 23 (1)
- 44 (4)
- 5 (1)
- 59 (1)
- 7 (1)
- 71 (1)
- 76 (1)
- 8 (1)
- 93 (1)
- [0.78-50 pg/ml] (3)
- [1.5-50 pg/ml] (3)
- [1.75-360 pg/ml] (3)
- [10-1540 pg/ml] (3)
- [10-1800 pg/ml] (6)
- [10-500 pg/ml] (3)
- [15.6-1000 pg/ml] (3)
- [18.8-540 pg/ml] (3)
- [2-360 pg/ml] (3)
- [20-3180 pg/ml] (3)
- [30-1540 pg/ml] (3)
- [31.25-1800 pg/ml] (3)
- [4-1000 pg/ml] (3)
- [4-1540 pg/ml] (3)
- [5-1000 pg/ml] (6)
- [5-500 pg/ml] (3)
- [6.6-1000 pg/ml] (3)
- [6.7-2250 pg/ml] (3)
- [7-1800 pg/ml] (3)
- [7.5-1000 pg/ml] (3)
- [ace2] (1)
- [chicken] (1)
- [co2-b039] (1)
- [cov-2- xbb.1] (1)
- [cov-2eg.5] (1)
- [cov-2xbb.1.31] (1)
- [cov-2xbb.2.3] (1)
- [cov2-alpha] (1)
- [cov2-ba.1] (1)
- [cov2-ba.2.3.20] (1)
- [cov2-ba.2.75.2+k444t] (1)
- [cov2-ba.2.75.2+v445p/f490s] (1)
- [cov2-ba.2.75.2] (1)
- [cov2-ba.2.75] (1)
- [cov2-ba.2] (1)
- [cov2-ba.4.6] (1)
- [cov2-ba.5] (1)
- [cov2-beta] (1)
- [cov2-bf.7/ba.5.2.6/bf.11] (1)
- [cov2-bn.1] (1)
- [cov2-bq.1.1] (1)
- [cov2-bq.1] (1)
- [cov2-br.2.1] (1)
- [cov2-ca.3.1] (1)
- [cov2-ch.1.1] (1)
- [cov2-delta] (1)
- [cov2-deltaplus] (1)
- [cov2-epsilon427] (1)
- [cov2-epsilon429] (1)
- [cov2-eta] (1)
- [cov2-gamma] (1)
- [cov2-iota] (1)
- [cov2-lambda] (1)
- [cov2-mu] (1)
- [cov2-wiuhan] (1)
- [cov2-xbb.1.16.1] (1)
- [cov2-xbb.1.16] (1)
- [cov2-xbb.1.5] (1)
- [cov2-xbb] (1)
- [cov2-xbf] (1)
- [cov2np] (1)
- [cr3018] (2)
- [cr3022] (4)
- [ctla-4-ig hum/hum] (4)
- [fla-1gs] (2)
- [flt-3l fc-g1] (2)
- [flt-3l-ig hum/hum] (2)
- [hea125] (1)
- [human fc-g1] (2)
- [ir162] (1)
- [ir31] (1)
- [ir418] (1)
- [ir863] (1)
- [m2a] (6)
- [m2ak] (1)
- [m2al] (1)
- [m2b] (7)
- [m2bk] (1)
- [m2bl] (1)
- [m3a] (1)
- [madnp-1] (1)
- [madnp-2] (1)
- [mak] (1)
- [mb2] (1)
- [mg1] (7)
- [mg1k] (1)
- [mg3] (6)
- [mg3k] (1)
- [mg3l] (1)
- [mm0297-9k20] (1)
- [mm2a] (1)
- [mmk] (1)
- [mml] (1)
- [mouse fc-g2a] (2)
- [rg1] (4)
- [rg1k] (1)
- [rg1l] (1)
- [rg2a] (4)
- [rg2ak] (1)
- [rg2al] (1)
- [rg2bk] (1)
- [rg2ck] (1)
- b2 (1)
- c3 (5)
- d5 (4)
- d6 (3)
- ir1060 (2)
- ir1148 (2)
- ir162 (2)
- ir2 (2)
- ir202 (2)
- ir22 (2)
- ir27 (2)
- ir304 (2)
- ir31 (2)
- ir418 (2)
- ir452 (2)
- ir473 (2)
- ir595 (2)
- ir863 (2)
- ir871 (2)
- kba.62 (2)
- madnp-1 (2)
- madnp-2 (2)
- madnp-3 (2)
- madnp-4 (2)
- madnp-5 (2)
- marg-coc-3 (2)
- n/a (3)
- polyclonal (1)
- s8 (1)
- y8 (1)
Applikation
- AM (8)
- AP (12916)
- ATPase Activity Assay (9)
- Activity Assay (1668)
- Apop (2)
- Array (12343)
- BLI (75)
- Bioassay (2717)
- Blocking (16347)
- CBA (23)
- CLIA (964)
- CM (3)
- Cell Assays (57)
- Cell Culture (2615)
- ChIP (113)
- CoIP (6)
- Coating Material (14)
- Conjugation (3)
- Control (35279)
- Control or Standard (1)
- Controls (20)
- Cytotoxic Assay (15)
- DARTs Assay (1)
- DID (1)
- DOT (141)
- Depletion (65)
- Double Diffusion (1)
- EIA (846)
- ELISA (60103)
- ELISpot (1706)
- EM (12)
- EMSA (4)
- EP (2)
- FA (6235)
- FACS (1852)
- FC (2126)
- FLISA (23)
- FluoroSpot (1704)
- Functional Studies (176)
- Functional studies (6)
- Gel Supershift Assays (2)
- HAI (3)
- HPLC (1658)
- HTS (4)
- Hemagglutination (4)
- IA (407)
- IAC (5)
- IB (7)
- ICC (170)
- ID (2)
- IEP (9)
- IF (276)
- IFA (4)
- IGS (36)
- IHC (5969)
- IHC-Fr (82)
- IHC-P (87)
- IM (11)
- IP (296)
- IgG and IgM detection in EIA (8)
- IgG/IgM detection (1)
- Immuno assays (2)
- Immunoassays (5)
- Immunocompetition (945)
- Immunodepletion (949)
- In situ hybridization (ISH) (1)
- In vitro (55)
- In vivo (14)
- Kinase Assay (3)
- LF (1584)
- Live Cell Imaging (3)
- MS (2038)
- MeDIP (1)
- Multiplex Assay (3)
- NT (21)
- NeA (1499)
- PA (5)
- PCR (17)
- Purification (8)
- RIA (12)
- RPR Card Test (3)
- Reagent Grade (1)
- Receptor Binding Assays (38)
- SB (1)
- SBR (283)
- SDS-PAGE (97087)
- Saliva Assays (1)
- Serum folate assays (1)
- Stabilizer and blocker (1)
- Standard (14)
- Standard or Control (1)
- Stem cell (1)
- Stim (3)
- Turbidimetry (11)
- Validation (1)
- Validation testing (1)
- WB (144378)
- biomarker (4)
- immunogen (34)
- light microscopy (LM) (1)
- metabolism (4)
- organoid (78)
- organoid culture (47)
- stem cell culture (124)
- xMAP (12)
SAMbetaA, CAS [[2429946-75-6]] Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3429 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
SAMbetaA (TFA)
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3429A |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 10 mg, 5 mg |
| Preise anzeigen | |
(0) Bilder
JM3A Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3430 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3431 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3431A |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
DfTat, CAS [[2035480-78-3]]
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3432 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 5 mg, 10 mg |
| Preise anzeigen | |
(0) Bilder
Sarafotoxin S6b, CAS [[120972-53-4]] Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3433 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
Ac-FEID-CMK Preis auf Anfrage
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3434 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 Unit |
| Preise anzeigen | |
(0) Bilder
Ac-FEID-CMK (TFA)
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3434A |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 1 mg, 5 mg, 10 mg |
| Preise anzeigen | |
(0) Bilder
WLSEAGPVVTVRALRGTGSW, CAS [[771479-86-8]]
- Bilder: 0
- Applikation: 0
| Artikelnummer: | MCE-HY-P3436 |
| Hersteller: | MedchemExpress |
| Applikation: | - |
| Kategorie: | Proteine/Peptide |
| Menge: | 10 mg, 1 mg, 5 mg |
| Preise anzeigen | |
(0) Bilder
