Recombinant Mycobacterium tuberculosis Uracil phosphoribosyltransferase (upp)

Artikelnummer: CSB-EP404542MON
Artikelname: Recombinant Mycobacterium tuberculosis Uracil phosphoribosyltransferase (upp)
Artikelnummer: CSB-EP404542MON
Hersteller Artikelnummer: CSB-EP404542MON
Alternativnummer: CSB-EP404542MON-1, CSB-EP404542MON-100, CSB-EP404542MON-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: UMP pyrophosphorylase,UPRTase
Molekulargewicht: 28.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: A5U7Y3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-207aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAETVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDLTDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTAAIDEGLNEVAYIVPGLGDAGDRQFGPR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.