Glutaredoxin-4, Recombinant, Shigella flexneri, aa1-115, HIs-Tag (GrxD)

Artikelnummer: USB-373471
Artikelname: Glutaredoxin-4, Recombinant, Shigella flexneri, aa1-115, HIs-Tag (GrxD)
Artikelnummer: USB-373471
Hersteller Artikelnummer: 373471
Alternativnummer: USB-373471-20, USB-373471-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. Source: Recombinant protein corresponding to aa1-115 from shigella flexneri Glutaredoxin-4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.9kD Amino Acid Sequence: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.9
UniProt: P0AC72
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.