Anti-SOX11
Catalog Number:
ATA-AMAB90502
- Images (6)
| Article Name: | Anti-SOX11 |
| Biozol Catalog Number: | ATA-AMAB90502 |
| Supplier Catalog Number: | AMAb90502 |
| Alternative Catalog Number: | ATA-AMAB90502-100,ATA-AMAB90502-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| SRY (sex determining region Y)-box 11 |
| Anti-SOX11 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0143] |
| Isotype: | IgG2a |
| NCBI: | 6664 |
| UniProt: | P35716 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SOX11 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected. |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: SOX11 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418895) |
|
|
AMAb90502-100ul |
|
|
AMAb90502-100ul |
|
|
AMAb90502-100ul |
Product Guarantee and Expert Support
