Anti-CA12 Antibody , IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-CA12 Antibody , IgG2a, Clone: [CL0278], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90637
• Supplier Catalog Number: AMAb90637
• Alternative Catalog Number: ATA-AMAB90637-100,ATA-AMAB90637-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HsT18816

Product Description

carbonic anhydrase XII

Additional Information

Anti-CA12

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL0278]
• Isotype: IgG2a
• NCBI: 771
• UniProt: O43570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CA12
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml

Images

Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules, but not glomeruli.

Immunohistochemical staining of human rectum shows strong membranous positivity in glandular epithelial cells.

Immunohistochemical staining of human stomach shows moderate membranous immunoreactivity in glandular cells.

Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells.

Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate

AMAb90637

AMAb90637

AMAb90637