Anti-FBRS Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA044117
Article Name: Anti-FBRS Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA044117
Supplier Catalog Number: HPA044117
Alternative Catalog Number: ATA-HPA044117-100,ATA-HPA044117-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FBS, FBS1, FLJ11618
Clonality: Polyclonal
NCBI: 64319
UniProt: Q9HAH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
Target: FBRS