Recombinant Human Sonic hedgehog protein(SHH), partial (Active)
Catalog Number:
CSB-AP000371HU
- Images (0)
| Article Name: | Recombinant Human Sonic hedgehog protein(SHH), partial (Active) |
| Biozol Catalog Number: | CSB-AP000371HU |
| Supplier Catalog Number: | CSB-AP000371HU |
| Alternative Catalog Number: | CSB-AP000371HU-500, CSB-AP000371HU-100, CSB-AP000371HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | SHH, |
| Molecular Weight: | 19.8 kDa |
| Tag: | Tag-Free |
| UniProt: | Q15465 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl |
| Source: | E.Coli |
| Expression System: | 25-197aa |
| Purity: | >98% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Product Guarantee and Expert Support
