Recombinant Human Fibroblast growth factor 4 protein(FGF4), partial (Active)
Catalog Number:
CSB-AP002411HU
- Images (0)
| Article Name: | Recombinant Human Fibroblast growth factor 4 protein(FGF4), partial (Active) |
| Biozol Catalog Number: | CSB-AP002411HU |
| Supplier Catalog Number: | CSB-AP002411HU |
| Alternative Catalog Number: | CSB-AP002411HU-500, CSB-AP002411HU-100, CSB-AP002411HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | FGF-4, HST, HST-1, HSTF-1, Heparin-binding growth factor 4 |
| Molecular Weight: | 19.8 kDa |
| Tag: | Tag-Free |
| UniProt: | P08620 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 300 mM NaCl |
| Source: | E.Coli |
| Expression System: | 25-206aa |
| Purity: | >96% as determined by SDSPAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
Product Guarantee and Expert Support
