Recombinant Human Vascular endothelial growth factor A protein(VEGFA), partial (Active)
Catalog Number:
CSB-AP002591HU
- Images (0)
| Article Name: | Recombinant Human Vascular endothelial growth factor A protein(VEGFA), partial (Active) |
| Biozol Catalog Number: | CSB-AP002591HU |
| Supplier Catalog Number: | CSB-AP002591HU |
| Alternative Catalog Number: | CSB-AP002591HU-500, CSB-AP002591HU-100, CSB-AP002591HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | VEGF-A, VPF |
| Molecular Weight: | 19.3 kDa |
| Tag: | Tag-Free |
| UniProt: | P15692 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
| Source: | Yeast |
| Expression System: | 27-191aa |
| Purity: | >97% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Product Guarantee and Expert Support
