Recombinant Human Noggin protein(NOG) (Active)
Catalog Number:
CSB-AP003011HU
- Images (0)
| Article Name: | Recombinant Human Noggin protein(NOG) (Active) |
| Biozol Catalog Number: | CSB-AP003011HU |
| Supplier Catalog Number: | CSB-AP003011HU |
| Alternative Catalog Number: | CSB-AP003011HU-500, CSB-AP003011HU-100, CSB-AP003011HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 23.2 kDa |
| Tag: | Tag-Free |
| UniProt: | Q13253 |
| Buffer: | Lyophilized from a 0.2 µm filtered 30 % acetonitrile, 0.1 % TFA |
| Source: | E.Coli |
| Expression System: | M+28-232aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | M+QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Product Guarantee and Expert Support
