Anti-GFAP, IgG1, Clone: [CL2713], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91033
Artikelname: Anti-GFAP, IgG1, Clone: [CL2713], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91033
Hersteller Artikelnummer: AMAb91033
Alternativnummer: ATA-AMAB91033-100,ATA-AMAB91033-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ45472
glial fibrillary acidic protein
Anti-GFAP
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL2713]
Isotyp: IgG1
NCBI: 2670
UniProt: P14136
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GFAP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the hippocampus.
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the cerebellum.
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the cerebellum.
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the brainstem.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91033 antibody. Corresponding GFAP RNA-seq data are presented for the same tissues.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GFAP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
Western blot analysis in mouse cerebral cortex tissue.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Mouse Cerebral Cortex tissue
AMAb91033
AMAb91033
AMAb91033