Anti-GFAP, IgG1, Clone: [CL2713], Mouse, Monoclonal
Catalog Number:
ATA-AMAB91033
- Images (15)
| Article Name: | Anti-GFAP, IgG1, Clone: [CL2713], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB91033 |
| Supplier Catalog Number: | AMAb91033 |
| Alternative Catalog Number: | ATA-AMAB91033-100,ATA-AMAB91033-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ45472 |
| glial fibrillary acidic protein |
| Anti-GFAP |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2713] |
| Isotype: | IgG1 |
| NCBI: | 2670 |
| UniProt: | P14136 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GFAP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the hippocampus. |
|
|
Immunofluorescence staining of rat brain shows strong positivity in astrocytes in the cerebellum. |
|
|
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the cerebellum. |
|
|
Immunofluorescence staining of mouse brain shows strong positivity in astrocytes in the brainstem. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91033 antibody. Corresponding GFAP RNA-seq data are presented for the same tissues. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GFAP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Cerebral Cortex tissue |
|
|
Western blot analysis in mouse cerebral cortex tissue. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue |
|
|
|
|
|
AMAb91033 |
|
|
AMAb91033 |
|
|
AMAb91033 |
Product Guarantee and Expert Support
