Recombinant Human Ribonuclease 4 (RNASE4), Unconjugated, Virus

Artikelnummer: BIM-RPC26328
Artikelname: Recombinant Human Ribonuclease 4 (RNASE4), Unconjugated, Virus
Artikelnummer: BIM-RPC26328
Hersteller Artikelnummer: RPC26328
Alternativnummer: BIM-RPC26328-20UG,BIM-RPC26328-100UG,BIM-RPC26328-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: RNS4
Accession Number: P34096. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 29~147aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cardiovascular. Shipping Condition: Ice packs. Short Description: Recombinant Human Ribonuclease 4 (RNASE4) is a purified Recombinant Protein
Molekulargewicht: 17.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Target-Kategorie: RNASE4