GRM7 (Metabotropic Glutamate Receptor 7, mGluR7, GPRC1G, MGLUR7, FLJ40498) (APC), Clone: [1H5], Mouse, Monoclonal

Artikelnummer: USB-127560-APC
Artikelname: GRM7 (Metabotropic Glutamate Receptor 7, mGluR7, GPRC1G, MGLUR7, FLJ40498) (APC), Clone: [1H5], Mouse, Monoclonal
Artikelnummer: USB-127560-APC
Hersteller Artikelnummer: 127560-APC
Alternativnummer: USB-127560-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa431-520 from human GRM7 (NP_000835) with GST tag. MW of the GST tag alone is 26kD.
Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1H5]
NCBI: 000844
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).