IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (APC), Clone: [3C8], Mouse, Monoclonal

Artikelnummer: USB-128417-APC
Artikelname: IL18R1 (Interleukin 18 Receptor 1, IL-18R-1, IL-18R1, CD218 Antigen-like Family Member A, CDw218a, IL1 Receptor-related Protein, IL-1Rrp, IL1R-rp, CD218a, IL1RRP) (APC), Clone: [3C8], Mouse, Monoclonal
Artikelnummer: USB-128417-APC
Hersteller Artikelnummer: 128417-APC
Alternativnummer: USB-128417-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Partial recombinant corresponding to aa22-122 from IL18R1 with GST tag. MW of the GST tag alone is 26kD.
Interleukin 18 receptor alpha is a member of the IL-1 receptor superfamily and has been designated IL-1 R5. Along with IL-1 R7, it forms a heterodimeric receptor for IL-18. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3C8]
NCBI: 003855
Reinheit: Purified by Protein A affinity chromatography
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).