Partial recombinant corresponding to aa22-122 from human IL2RA (NP_000408) with GST tag. MW of the GST tag alone is 26kD.
IL-2 receptor alpha (IL-2 RA), also known as CD25, is a 55kD type I membrane glycoprotein that belongs to a family of cytokine receptors that utilize the common gamma chain subunit (Gc). IL-2 RA is primarily expressed on activated T cells and on regulatory T cells (Treg). IL-2 RABBIT (CD122) and Gc (IL-2 RG/CD132) dimerize to form a constitutively expressed intermediate affinity IL-2 receptor. By itself, IL-2 RA binds IL-2 with low affinity. It associates with IL-2 RB and GC to generate a ternary high affinity IL-2 receptor complex. A soluble form of IL-2 RA can be generated by proteolytic cleavage of the cell surface receptor, rendering the T cell unresponsive to IL-2. Increased serum levels of soluble IL-2 RA are found in some cancers and immune disorders. IL-2 RA is required for activation-induced cell death (AICD) of naive T cells, a mechanism responsible for deleting autoreactive T cell clones. IL-2 RA is also required for the development of CD4+CD25+ Treg which suppress autoreactive CD4+ T cells, thereby contributing to peripheral T cell homeostasis. Within the ECD, canine IL-2 RA shares 49%-60% aa sequence identity with human, mouse, and rat IL-2 RA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
