Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15,
Artikelnummer:
USB-129456-APC
- Bilder (0)
| Artikelname: | Matriptase (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, |
| Artikelnummer: | USB-129456-APC |
| Hersteller Artikelnummer: | 129456-APC |
| Alternativnummer: | USB-129456-APC-100 |
| Hersteller: | US Biological |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | FLISA |
| Immunogen: | Partial recombinant corresponding to aa298-401 from human ST14 (NP_068813) with GST tag. MW of the GST tag alone is 26kD. |
| Matriptase or MT-SP1 is an epithelial-derived type II transmembrane serine protease that is highly expressd in human cancer-derived cell lines. Matriptase cleaves and activates protease activated receptor-2, pro-urokinase plasminogen activator and pro-hepatocyte growth factor. Matriptase is strongly inhibited by the hepatocyte growth factor activator inhibitor type 1 (HAI-1), which is a reactive site loop of Kunitz domain and also a transmembrane serine protease inhibitor. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD* Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody. |
Produktgarantie und fachkundiger Support
