SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (Biotin), Clone: [4F9], Mouse, Monoclonal

Artikelnummer: USB-133325-BIOTIN
Artikelname: SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (Biotin), Clone: [4F9], Mouse, Monoclonal
Artikelnummer: USB-133325-BIOTIN
Hersteller Artikelnummer: 133325-Biotin
Alternativnummer: USB-133325-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa374-482 from human SHMT1 with GST tag. MW of the GST tag alone is 26kD.
This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4F9]
NCBI: 004169
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.