SLC15A1 (Solute Carrier Family 15 Member 1, Intestinal H(+)/Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1) (HRP), Clone: [1F8], Mouse, Monoclonal

Artikelnummer: USB-133406-HRP
Artikelname: SLC15A1 (Solute Carrier Family 15 Member 1, Intestinal H(+)/Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1) (HRP), Clone: [1F8], Mouse, Monoclonal
Artikelnummer: USB-133406-HRP
Hersteller Artikelnummer: 133406-HRP
Alternativnummer: USB-133406-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa473-573 from human SLC15A1 (NP_005064) with GST tag. MW of the GST tag alone is 26kD.
Proton-coupled intake of oligopeptides of 2 to 4aa with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1F8]
NCBI: 005073
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).