SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, BHLHd1) (Biotin), Clone: [4B10], Mouse, Monoclonal

Artikelnummer: USB-133827-BIOTIN
Artikelname: SREBF1 (Sterol Regulatory Element Binding Transcription Factor 1, SREBP-1c, SREBP1, BHLHd1) (Biotin), Clone: [4B10], Mouse, Monoclonal
Artikelnummer: USB-133827-BIOTIN
Hersteller Artikelnummer: 133827-Biotin
Alternativnummer: USB-133827-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa801-900 from human SREBF1 (AAH57388) with GST tag. MW of the GST tag alone is 26kD.
SREBF1 is a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B10]
NCBI: 057388
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.