TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (PE), Clone: [2G5], Mouse, Monoclonal

Artikelnummer: USB-134350-PE
Artikelname: TFAP2A (Transcription Factor AP-2-alpha, AP2-alpha, AP-2 Transcription Factor, Activating Enhancer-binding Protein 2-alpha, Activator Protein 2, AP-2, AP2TF, TFAP2, FLJ51761) (PE), Clone: [2G5], Mouse, Monoclonal
Artikelnummer: USB-134350-PE
Hersteller Artikelnummer: 134350-PE
Alternativnummer: USB-134350-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa99-205 from human TFAP2A (AAH17754) with GST tag. MW of the GST tag alone is 26kD.
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5-GCCNNNGGC-3 and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2G5]
NCBI: 017754
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).