HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL), Clone: [1A4], Mouse, Monoclonal

Produktübersicht

• Artikelname: HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL), Clone: [1A4], Mouse, Monoclonal
• Artikelnummer: USB-246931
• Hersteller Artikelnummer: 246931
• Alternativnummer: USB-246931-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA
• Immunogen: HBEGF (AAH33097.1, 20aa-208aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Mouse monoclonal antibody raised against a full-length recombinant HBEGF. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [1A4]
• NCBI: 33097
• Reinheit: Purified
• Formulierung: Supplied as a liquid in PBS, pH 7.4.