MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (Biotin), Clone: [2D9], Mouse, Monoclonal

Artikelnummer: USB-248607-BIOTIN
Artikelname: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (Biotin), Clone: [2D9], Mouse, Monoclonal
Artikelnummer: USB-248607-BIOTIN
Hersteller Artikelnummer: 248607-Biotin
Alternativnummer: USB-248607-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Immunogen: MDH2 (NP_005909, 134aa-246aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D9]
NCBI: 005909
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.