RPA1 (RPA70, Replication Protein A 70kD DNA-Binding Subunit, Replication Protein A, REPA1, RF-A Protein 1, RFA1, RPA 70, RP-A p70, RPA70, RPA-70), Rabbit
RPA1 (RPA70, Replication Protein A 70kD DNA-Binding Subunit, Replication Protein A, REPA1, RF-A Protein 1, RFA1, RPA 70, RP-A p70, RPA70, RPA-70), Rabbit
RPA1 (RPA70, Replication Protein A 70kD DNA-Binding Subunit, Replication Protein A, REPA1, RF-A Protein 1, RFA1, RPA 70, RP-A p70, RPA70, RPA-70), Rabbit
Artikelnummer:
USB-353024
Hersteller Artikelnummer:
353024
Alternativnummer:
USB-353024-100
Hersteller:
US Biological
Wirt:
Rabbit
Kategorie:
Antikörper
Applikation:
WB
Immunogen:
Synthetic peptide corresponding to aa533-568 QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANF of human RPA1 at C-terminal.
Replication protein A 70kD DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70kD (RPA1), 32kD (RPA2), and 14kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.