EPCAM (Epithelial Cell Adhesion Molecule, 17-1A, 323/A3, CD326, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, HEA125, KS1/4, KSA, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1, hEGP-2), Clone: [2F34],
Artikelnummer:
USB-377151
- Bilder (0)
| Artikelname: | EPCAM (Epithelial Cell Adhesion Molecule, 17-1A, 323/A3, CD326, CO-17A, CO17-1A, EGP, EGP-2, EGP34, EGP40, ESA, Ep-CAM, GA733-2, HEA125, KS1/4, KSA, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1, hEGP-2), Clone: [2F34], |
| Artikelnummer: | USB-377151 |
| Hersteller Artikelnummer: | 377151 |
| Alternativnummer: | USB-377151-100 |
| Hersteller: | US Biological |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Immunogen: | Recombinant protein corresponding to aa24-265 from partial human EPCAM, fused to GST-Tag. |
| This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVIC SKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLY DPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDT EITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEIT TRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIAD VAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTL IYYVDEKAPEFSMQGLK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
