Anti-SUR1 [N289/16], Rabbit IgG, kappa, Monoclonal

Artikelnummer: ABA-AB02165-23.0
Artikelname: Anti-SUR1 [N289/16], Rabbit IgG, kappa, Monoclonal
Artikelnummer: ABA-AB02165-23.0
Hersteller Artikelnummer: Ab02165-23.0
Alternativnummer: ABA-AB02165-23.0
Hersteller: Absolute Antibody
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Hamster, Mouse, Rat
Alternative Synonym: N289/16R, ATP-binding cassette sub-family C member 8, Sulfonylurea receptor 1, Abcc8
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
Klonalität: Monoclonal
Klon-Bezeichnung: [N289/16]
Isotyp: IgG
UniProt: Q09429
Puffer: PBS with 0.02% Proclin 300.
Quelle: Mouse
Target-Kategorie: SUR1
Antibody Type: Recombinant Antibody