Anti-SUR1 [N289/16], Rat IgG2b, kappa, Monoclonal

Produktübersicht

• Artikelname: Anti-SUR1 [N289/16], Rat IgG2b, kappa, Monoclonal
• Artikelnummer: ABA-AB02165-8.1
• Hersteller Artikelnummer: Ab02165-8.1
• Alternativnummer: ABA-AB02165-8.1
• Hersteller: Absolute Antibody
• Wirt: Rat
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Hamster, Mouse, Rat
• Alternative Synonym: N289/16R, ATP-binding cassette sub-family C member 8, Sulfonylurea receptor 1, Abcc8

Produktbeschreibung

This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [N289/16]
• Isotyp: IgG2b
• UniProt: Q09429
• Puffer: PBS with 0.02% Proclin 300.
• Quelle: Mouse
• Target-Kategorie: SUR1
• Antibody Type: Recombinant Antibody