Anti-OPG [AbAb02OPG], Mouse IgG1, kappa, Monoclonal

Artikelnummer: ABA-AB04114-1.1
Artikelname: Anti-OPG [AbAb02OPG], Mouse IgG1, kappa, Monoclonal
Artikelnummer: ABA-AB04114-1.1
Hersteller Artikelnummer: Ab04114-1.1
Alternativnummer: ABA-AB04114-1.1
Hersteller: Absolute Antibody
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Alternative Synonym: Osteoprotegerin, OCIF, PDB5, TR1, TNFRSF11B, Tumor necrosis factor receptor superfamily member 11b, TNF receptor superfamily member 11b, Osteoclastogenesis inhibitory factor
The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).
Klonalität: Monoclonal
Klon-Bezeichnung: [AbAb02OPG]
Isotyp: IgG1
UniProt: O00300
Puffer: PBS with 0.02% Proclin 300.
Target-Kategorie: OPG