Anti-Phospholipase A2 [AbAb01-PLA2], Rabbit IgG-Fc Fusion,, Monoclonal

Artikelnummer: ABA-AB04530-23.159
Artikelname: Anti-Phospholipase A2 [AbAb01-PLA2], Rabbit IgG-Fc Fusion,, Monoclonal
Artikelnummer: ABA-AB04530-23.159
Hersteller Artikelnummer: Ab04530-23.159
Alternativnummer: ABA-AB04530-23.159
Hersteller: Absolute Antibody
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Snake
Alternative Synonym: PLA2, Snake venom phospholipase A2, Phospholipase A2 5
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generated this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.
Klonalität: Monoclonal
Klon-Bezeichnung: [AbAb01-PLA2]
Puffer: PBS with 0.02% Proclin 300.
Target-Kategorie: Phospholipase A2