Anti-Phospholipase A2 [AbAb01-PLA2], Camelid VHH, His-tagged,, Camelus, Monoclonal

Artikelnummer: ABA-AB04530-34.11
Artikelname: Anti-Phospholipase A2 [AbAb01-PLA2], Camelid VHH, His-tagged,, Camelus, Monoclonal
Artikelnummer: ABA-AB04530-34.11
Hersteller Artikelnummer: Ab04530-34.11
Alternativnummer: ABA-AB04530-34.11
Hersteller: Absolute Antibody
Wirt: Camelus
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Snake
Alternative Synonym: PLA2, Snake venom phospholipase A2, Phospholipase A2 5
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generated this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.
Klonalität: Monoclonal
Klon-Bezeichnung: [AbAb01-PLA2]
Puffer: PBS with 0.02% Proclin 300.
Target-Kategorie: Phospholipase A2