Caveolin-1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0059
Artikelname: Caveolin-1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0059
Hersteller Artikelnummer: A0059
Alternativnummer: ABB-A0059-100UL,ABB-A0059-20UL,ABB-A0059-500UL,ABB-A0059-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CGL3, PPH3, BSCL3, LCCNS, VIP21, MSTP085, Caveolin-1
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 857
UniProt: Q03135
Reinheit: Affinity purification
Sequenz: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY
Target-Kategorie: CAV1
Antibody Type: Primary Antibody
Application Verdünnung: IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Insulin Receptor Signaling Pathway,Cardiovascular,Hypoxia,Lipids