MMP14/MT1-MMP Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: MMP14/MT1-MMP Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0067
• Hersteller Artikelnummer: A0067
• Alternativnummer: ABB-A0067-100UL,ABB-A0067-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, FC, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1, MMP14/MT1-MMP

Produktbeschreibung

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0211]
• Molekulargewicht: 66kDa
• NCBI: 4323
• UniProt: P50281
• Reinheit: Affinity purification
• Sequenz: GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
• Target-Kategorie: MMP14
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P, 1:50 - 1:200|FC, 1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin,Endocrine Metabolism,Cardiovascular,Angiogenesis,Hypoxia

Bilder