FGFR1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FGFR1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A0082
• Hersteller Artikelnummer: A0082
• Alternativnummer: ABB-A0082-1000UL,ABB-A0082-20UL,ABB-A0082-500UL,ABB-A0082-100UL,ABB-A0082-200UL,ABB-A0082-50UL,ABB-A0082-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FGFR1 (NP_075598.2).
• Konjugation: Unconjugated
• Alternative Synonym: CEK, FLG, HH2, OGD, ECCL, FLT2, KAL2, BFGFR, CD331, FGFBR, FLT-2, HBGFR, N-SAM, FGFR-1, HRTFDS, bFGF-R-1, FGFR1

Produktbeschreibung

The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affin

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 92kDa
• NCBI: 2260
• UniProt: P11362
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: IGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMK
• Target-Kategorie: FGFR1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,ESC Pluripotency and Differentiation,Immunology I