DUSP6 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0133
Artikelname: DUSP6 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0133
Hersteller Artikelnummer: A0133
Alternativnummer: ABB-A0133-100UL,ABB-A0133-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HH19, MKP3, PYST1, DUSP6
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0237]
Molekulargewicht: 42kDa
NCBI: 1848
UniProt: Q16828
Reinheit: Affinity purification
Sequenz: ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
Target-Kategorie: DUSP6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Immunology Inflammation,Neuroscience