PGP9.5/UCHL1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PGP9.5/UCHL1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0148
• Hersteller Artikelnummer: A0148
• Alternativnummer: ABB-A0148-100UL,ABB-A0148-20UL,ABB-A0148-500UL,ABB-A0148-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NDGOA, PARK5, PGP95, SPG79, PGP9.5, SPG79A, UCHL-1, Uch-L1, HEL-117, PGP 9.5, HEL-S-53, PGP9.5/UCHL1

Produktbeschreibung

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 25kDa
• NCBI: 7345
• UniProt: P09936
• Reinheit: Affinity purification
• Sequenz: HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
• Target-Kategorie: UCHL1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Neuron marker.