IRF7 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: IRF7 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0159
• Hersteller Artikelnummer: A0159
• Alternativnummer: ABB-A0159-100UL,ABB-A0159-20UL,ABB-A0159-1000UL,ABB-A0159-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IMD39, IRF-7, IRF7A, IRF7B, IRF7C, IRF7H, IRF-7H, IRF7

Produktbeschreibung

This gene encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. It has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. The encoded protein plays an important role in the innate immune response against DNA and RNA viruses.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 3665
• UniProt: Q92985
• Reinheit: Affinity purification
• Sequenz: KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
• Target-Kategorie: IRF7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,Cytokines,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling.