Hexokinase II Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Hexokinase II Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0165
• Hersteller Artikelnummer: A0165
• Alternativnummer: ABB-A0165-100UL,ABB-A0165-20UL,ABB-A0165-500UL,ABB-A0165-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HKII, HXK2, II

Produktbeschreibung

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 102kDa
• NCBI: 3099
• UniProt: P52789
• Reinheit: Affinity purification
• Sequenz: MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
• Target-Kategorie: HK2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Warburg Effect,Cardiovascular,Heart

Bilder