Tec Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Tec Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0189
• Hersteller Artikelnummer: A0189
• Alternativnummer: ABB-A0189-100UL,ABB-A0189-20UL,ABB-A0189-1000UL,ABB-A0189-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PSCTK4, Tec

Produktbeschreibung

The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 74 kDa
• NCBI: 7006
• UniProt: P42680
• Reinheit: Affinity purification
• Sequenz: MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRS
• Target-Kategorie: TEC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:5000|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Immunology Inflammation.

Bilder

Immunohistochemistry analysis of paraffin-embedded Human colon using Tec Rabbit pAb (A0189) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using Tec Rabbit pAb (A0189) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of various lysates using Tec Rabbit pAb (A0189) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
DeTection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Tec Rabbit pAb (A0189) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using Tec Rabbit pAb (A0189) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunofluorescence analysis of Jurkat cells using Tec Rabbit pAb (A0189) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.