CaMKII Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: CaMKII Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0198
• Hersteller Artikelnummer: A0198
• Alternativnummer: ABB-A0198-100UL,ABB-A0198-20UL,ABB-A0198-1000UL,ABB-A0198-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CAM2, CAMK2, CAMKB, MRD54, CaMKIIbeta, CaMKII

Produktbeschreibung

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1814]
• Molekulargewicht: 73kDa
• NCBI: 816
• UniProt: Q13554
• Reinheit: Affinity purification
• Sequenz: GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
• Target-Kategorie: CAMK2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker

Bilder