CaMKII Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: CaMKII Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0198
• Hersteller Artikelnummer: A0198
• Alternativnummer: ABB-A0198-100UL,ABB-A0198-20UL,ABB-A0198-1000UL,ABB-A0198-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CAM2, CAMK2, CAMKB, MRD54, CaMKIIbeta, CaMKII

Produktbeschreibung

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1814]
• Molekulargewicht: 73kDa
• NCBI: 816
• UniProt: Q13554
• Reinheit: Affinity purification
• Sequenz: GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
• Target-Kategorie: CAMK2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker.

Bilder

Western blot analysis of various lysates using CaMKII Rabbit mAb (A0198) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CaMKII Rabbit mAb (A0198) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using CaMKII Rabbit mAb (A0198) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.