Bid Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Bid Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0210
• Hersteller Artikelnummer: A0210
• Alternativnummer: ABB-A0210-20UL,ABB-A0210-100UL,ABB-A0210-500UL,ABB-A0210-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FP497, Bid

Produktbeschreibung

This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8), CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 637
• UniProt: P55957
• Reinheit: Affinity purification
• Sequenz: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• Target-Kategorie: BID
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases

Bilder