Bid Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0210
- Bilder (2)
| Artikelname: | Bid Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0210 |
| Hersteller Artikelnummer: | A0210 |
| Alternativnummer: | ABB-A0210-20UL,ABB-A0210-100UL,ABB-A0210-500UL,ABB-A0210-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FP497, Bid |
| This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8), CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 22kDa |
| NCBI: | 637 |
| UniProt: | P55957 |
| Reinheit: | Affinity purification |
| Sequenz: | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
| Target-Kategorie: | BID |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Invasion and Metastasis,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases. |


