Bmi1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Bmi1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0211
• Hersteller Artikelnummer: A0211
• Alternativnummer: ABB-A0211-100UL,ABB-A0211-20UL,ABB-A0211-1000UL,ABB-A0211-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PCGF4, RNF51, FLVI2/BMI1, flvi-2/bmi-1, Bmi1

Produktbeschreibung

This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 648
• UniProt: P35226
• Reinheit: Affinity purification
• Sequenz: LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
• Target-Kategorie: BMI1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint

Bilder