Bmi1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0211
Artikelname: Bmi1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0211
Hersteller Artikelnummer: A0211
Alternativnummer: ABB-A0211-100UL,ABB-A0211-20UL,ABB-A0211-1000UL,ABB-A0211-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PCGF4, RNF51, FLVI2/BMI1, flvi-2/bmi-1, Bmi1
This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 648
UniProt: P35226
Reinheit: Affinity purification
Sequenz: LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
Target-Kategorie: BMI1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint