Caspase-8 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0215
Artikelname: Caspase-8 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0215
Hersteller Artikelnummer: A0215
Alternativnummer: ABB-A0215-100UL,ABB-A0215-20UL,ABB-A0215-500UL,ABB-A0215-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8, Caspase-8
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 841
UniProt: Q14790
Reinheit: Affinity purification
Sequenz: EEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Target-Kategorie: CASP8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Ubiquitin,Death Receptor Signaling Pathway,Endocrine Metabolism,Immunology Inflammation,Toll-like Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases