CDK1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CDK1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0220
• Hersteller Artikelnummer: A0220
• Alternativnummer: ABB-A0220-100UL,ABB-A0220-20UL,ABB-A0220-1000UL,ABB-A0220-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CDC2, CDC28A, P34CDC2, CDK1

Produktbeschreibung

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 983
• UniProt: P06493
• Reinheit: Affinity purification
• Sequenz: ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
• Target-Kategorie: CDK1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|IP,2µg antibody for 200µgextracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint,Microtubules,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases

Bilder