CDK1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0220
Artikelname: CDK1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0220
Hersteller Artikelnummer: A0220
Alternativnummer: ABB-A0220-100UL,ABB-A0220-20UL,ABB-A0220-1000UL,ABB-A0220-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CDC2, CDC28A, P34CDC2, CDK1
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 983
UniProt: P06493
Reinheit: Affinity purification
Sequenz: ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Target-Kategorie: CDK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|IP,2µg antibody for 200µgextracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint,Microtubules,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases.