GFAP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GFAP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0237
• Hersteller Artikelnummer: A0237
• Alternativnummer: ABB-A0237-100UL,ABB-A0237-20UL,ABB-A0237-1000UL,ABB-A0237-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ALXDRD, GFAP

Produktbeschreibung

This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 2670
• UniProt: P14136
• Reinheit: Affinity purification
• Sequenz: MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMME
• Target-Kategorie: GFAP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells,Astrocyte marker

Bilder