IKKepsilon Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: IKKepsilon Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0244
• Hersteller Artikelnummer: A0244
• Alternativnummer: ABB-A0244-20UL,ABB-A0244-100UL,ABB-A0244-500UL,ABB-A0244-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IKKE, IKKI, IKK-E, IKK-i, IKKepsilon

Produktbeschreibung

IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 80kDa
• NCBI: 9641
• UniProt: Q14164
• Reinheit: Affinity purification
• Sequenz: SRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
• Target-Kategorie: IKBKE
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Death Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling

Bilder